The domain within your query sequence starts at position 18 and ends at position 307; the E-value for the TPT domain shown below is 6.4e-18.

VFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKTLRVVKF
PDFDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGALLKKTF
SWGIKMTVFAMIIGAFVAASSDLAFDLEGYVFILINDVLTAANGAYVKQKLDSKELGKYG
LLYYNALFMILPTLAIAYFTGDAQKAMEFEGWADTLFLLQFTLSCVMGFILMYATVLCTQ
YNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYS

TPT

TPT
PFAM accession number:PF03151
Interpro abstract (IPR004853):

This domain is found in a number of sugar phosphate transporters, including those with a specificity for triose phosphate [(PUBMED:11432728)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPT