The domain within your query sequence starts at position 1 and ends at position 138; the E-value for the TP_methylase domain shown below is 3.7e-22.

MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLILADREE
VEQEADNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIPYQVIHNASIMNAVGCC
GLQVMPQRKCVLFPGSYK

TP_methylase

 TP_methylase
PFAM accession number:PF00590
Interpro abstract (IPR000878):

Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [(PUBMED:11215515)]. The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including cobalamin (vitamin B12), haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin [(PUBMED:17227226)].

These enzymes catalyse the methylation of their substrates using S-adenosyl-L-methionine as a methyl source. Enzymes in this family include:

  • Uroporphyrinogen III methyltransferase (EC 2.1.1.107) (SUMT), which catalyses the conversion of uroporphyrinogen III to precorrin-2 at the first branch-point of the tetrapyrrole synthesis pathway, directing the pathway towards cobalamin or sirohaem synthesis [(PUBMED:15522295)].
  • Precorrin-2 C20-methyltransferase CobI/CbiL (EC 2.1.1.130), which introduces a methyl group at C-20 on precorrin-2 to produce precorrin-3A during cobalamin biosynthesis. This reaction is key to the conversion of a porphyrin-type tetrapyrrole ring to a corrin ring [(PUBMED:17229157)]. In some species, this enzyme is part of a bifunctional protein.
  • Precorrin-4 C11-methyltransferase CobM/CbiF (EC 2.1.1.133), which introduces a methyl group at C-11 on precorrin-4 to produce precorrin-5 during cobalamin biosynthesis [(PUBMED:16866557)].
  • Sirohaem synthase CysG (EC 2.1.1.107), domains 4 and 5, which synthesizes sirohaem from uroporphyrinogen III, at the first branch-point in the tetrapyrrole biosynthetic pathway, directing the pathway towards sirohaem synthesis [(PUBMED:14595395)].
  • Diphthine synthase (EC 2.1.1.98), which carries out the methylation step during the modification of a specific histidine residue of elongation factor 2 (EF-2) during diphthine synthesis.

This entry represents a tetrapyrrole methylase domain, which consist of two non-similar subdomains [(PUBMED:15522295)].

GO process:metabolic process (GO:0008152)
GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TP_methylase