The domain within your query sequence starts at position 47 and ends at position 114; the E-value for the TRAM1 domain shown below is 4.2e-21.
SIAFLTLQHGVVVPAEGLPSGSRTLYHYGVKDLATVFFYMLVAIIIHATIQEYVLDKLSR RLQLTKGK
TRAM1 |
---|
PFAM accession number: | PF08390 |
---|---|
Interpro abstract (IPR013599): | This family comprises sequences that are similar to human TRAM1 ( Q15629 ). This is a transmembrane protein of the endoplasmic reticulum, thought to be involved in the membrane transfer of secretory proteins [ (PUBMED:1315422) ]. The region featured in this family is found N-terminal to the longevity-assurance protein region ( IPR006634 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAM1