The domain within your query sequence starts at position 47 and ends at position 115; the E-value for the TRAM1 domain shown below is 6.1e-24.

AIIFVALQYNVTRPATEEQATESASLYHYGIKDLATVLFYMLVAIIIHAIIQEYVLDKIN
RRMHFSKTK

TRAM1

TRAM1
PFAM accession number:PF08390
Interpro abstract (IPR013599):

This family comprises sequences that are similar to human TRAM1 ( Q15629 ). This is a transmembrane protein of the endoplasmic reticulum, thought to be involved in the membrane transfer of secretory proteins [ (PUBMED:1315422) ]. The region featured in this family is found N-terminal to the longevity-assurance protein region ( IPR006634 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAM1