The domain within your query sequence starts at position 4 and ends at position 172; the E-value for the TRAP-delta domain shown below is 3.7e-81.
MASFGALALLLLSGLSCCSEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNM ALYADVSGKQFPVTRGQDVGRYQVSWSLEHKSAHAGTYEVRFFDEESYSLLRKAQRNNED VSIIPPLFTVSVDHRGTWNGPWVSTEVLAAVIGIVIYYLAFSAKSHIQA
TRAP-delta |
---|
PFAM accession number: | PF05404 |
---|---|
Interpro abstract (IPR008855): | This family consists of several eukaryotic translocon-associated protein, delta subunit precursors (TRAP-delta or SSR-delta). The exact function of this protein is unknown [ (PUBMED:7492314) ]. |
GO component: | endoplasmic reticulum (GO:0005783), integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAP-delta