The domain within your query sequence starts at position 6 and ends at position 173; the E-value for the TRAP-delta domain shown below is 4.7e-81.

SFGALALLLLSGLSCCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMA
LYADVSGKQFPVTRGQDVGRYQVSWSLEHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDV
SIIPPLFTVSVDHRGTWNGPWVSTEVLAAVIGIVIYYLAFSAKSHIQA

TRAP-delta

• PFAM accession number: PF05404
• Interpro abstract (IPR008855):

  This family consists of several eukaryotic translocon-associated protein, delta subunit precursors (TRAP-delta or SSR-delta). The exact function of this protein is unknown [ (PUBMED:7492314) ].

• GO component: endoplasmic reticulum (GO:0005783), integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAP-delta