The domain within your query sequence starts at position 12 and ends at position 179; the E-value for the TRAP-gamma domain shown below is 4.3e-85.

EEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTY
LVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADY
EATTFSIFYNNTLFLVLVIVASFFILKNFNPTVYPLESFPINSSLLCF

TRAP-gamma

 TRAP-gamma
PFAM accession number:PF07074
Interpro abstract (IPR009779):

The translocon-associated protein (TRAP, also known as the signal sequence receptor) complex is required for the efficient translocation of secretory and membrane proteins in the endoplasmic reticulum, and is also involved in the endoplasmic reticulum stress-mediated unfolded protein response pathway. This entry represents the gamma subunit of the translocon-associated proteins. Trap-gamma (also known as SSR3) appears to be required for vascular network formation in murine placental development [ (PUBMED:21246656) ].

GO process:SRP-dependent cotranslational protein targeting to membrane (GO:0006614)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAP-gamma