The domain within your query sequence starts at position 28 and ends at position 177; the E-value for the TRAPP domain shown below is 3.2e-39.

AFALLFSELVQHCQSRVFSVAELQARLAALGRQVGARVLDALVAREKGARRETKVLGALL
FVKGAVWKALFGKEADKLEQANDDARTFYIIEREPLINTYISVPKENSTLNCASFTAGIV
EAVLTHSGFPAKVTAHWHKGTTLMIKFEEA

TRAPP

TRAPP
PFAM accession number:PF04051
Interpro abstract (IPR007194):

TRAPP plays a key role in the targeting and/or fusion of ER-to-Golgi transport vesicles with their acceptor compartment. TRAPP is a large multimeric protein that contains at least 10 subunits. This family contains many TRAPP family proteins. The Bet3 subunit is one of the better characterised TRAPP proteins and has a dimeric structure [(PUBMED:15608655)] with hydrophobic channels. The channel entrances are located on a putative membrane-interacting surface that is distinctively flat, wide and decorated with positively charged residues. Bet3 is proposed to localise TRAPP to the Golgi [(PUBMED:9564032)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAPP