The domain within your query sequence starts at position 152 and ends at position 605; the E-value for the TRAPPC-Trs85 domain shown below is 9.3e-135.

ASSGEAEPMEQFSKLSQEQHRIQHNNDYSYPKWFIPNTLKYYVLLHDVTSGDEQRAESIY
EEMKQKYGTQGCYLLKINSRAPNRASDEQIPDPWSQYLQKNSIQNQESYEDGPCTMTSSK
NSDSNLLSLDGLDNEVKVDGLPNNFRIHPLQIDQCGDPPNNTDGSESKSASSVHETKKAS
TAVIRGACLTLTDHDRIRQFIQEFTFRGLLPHIEKTIRQLNDQLISRKGLSRSLFSATKK
WFSGSKVPEKSINELKNTSGLLYPPEAPELQIRKMADLCFLVQHYDLAYSCYHTAKKDFL
NDQAMLYAAGALEMAAVSAFLQPGAPRPYPAHYMDTAIQTYRDICKNMVLAERCVLLSAE
ILKSQSKYSEAAALLIRLTSEDSDLRSALLLEQAAHCFINMKSPMVRKYAFHMILAGHRF
SKAGQKKHALRCYCQAMQVYKGKGWSLAEDHINF

TRAPPC-Trs85

TRAPPC-Trs85
PFAM accession number:PF12739
Interpro abstract (IPR024420): This entry represents Trs85, a subunit of the TRAPP III complex [(PUBMED:20375281)]. Trs85 is a multimeric guanine nucleotide-exchange factor for Ypt1, required for membrane expansion during autophagy and the CVT pathway. It directs Ypt1 to the phagophore assembly site [(PUBMED:9504908), (PUBMED:8619313), (PUBMED:16874038), (PUBMED:16079147)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAPPC-Trs85