The domain within your query sequence starts at position 6 and ends at position 285; the E-value for the TRAP_alpha domain shown below is 1.1e-124.

RLLLLFLLAFPAAVLLRGGPGGSLALAQDPTEDEEIVEDSIIEDEDDEAEVEEDEPTDLA
EDKEEEDVSSEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFR
YPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVF
QDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLLESRKRKRPIQKVEMGT
SSQNDVDMSWIPQETLNQINKASPRRQPRKRAQKRSVGSD

TRAP_alpha

TRAP_alpha
PFAM accession number:PF03896
Interpro abstract (IPR005595):

The alpha-subunit of the TRAP (translocon-associated protein) complex is a single-spanning membrane protein of the endoplasmic reticulum (ER) [(PUBMED:8050590)]. The four-subunit (alpha, beta, gamma and delta) TRAP complex localises in the ER membrane and associates with the Sec61 translocon as a heterotetramer [(PUBMED:15811380)]. It also interacts with palmitoylated calnexin (CALX), the interaction is required for efficient folding of glycosylated proteins [(PUBMED:22314232)]. TRAP complex may also be involved in endoplasmic reticulum-associated degradation [(PUBMED:17380188)].

GO component:endoplasmic reticulum membrane (GO:0005789)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAP_alpha