The domain within your query sequence starts at position 6 and ends at position 285; the E-value for the TRAP_alpha domain shown below is 1.1e-124.
RLLLLFLLAFPAAVLLRGGPGGSLALAQDPTEDEEIVEDSIIEDEDDEAEVEEDEPTDLA EDKEEEDVSSEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFR YPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVF QDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLLESRKRKRPIQKVEMGT SSQNDVDMSWIPQETLNQINKASPRRQPRKRAQKRSVGSD
TRAP_alpha |
---|
PFAM accession number: | PF03896 |
---|---|
Interpro abstract (IPR005595): | The alpha-subunit of the TRAP (translocon-associated protein) complex is a single-spanning membrane protein of the endoplasmic reticulum (ER) [ (PUBMED:8050590) ]. The four-subunit (alpha, beta, gamma and delta) TRAP complex localises in the ER membrane and associates with the Sec61 translocon as a heterotetramer [ (PUBMED:15811380) ]. It also interacts with palmitoylated calnexin (CALX), the interaction is required for efficient folding of glycosylated proteins [ (PUBMED:22314232) ]. TRAP complex may also be involved in endoplasmic reticulum-associated degradation [ (PUBMED:17380188) ]. |
GO component: | endoplasmic reticulum membrane (GO:0005789) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAP_alpha