The domain within your query sequence starts at position 8 and ends at position 506; the E-value for the TRC8_N domain shown below is 2.8e-156.

EAVLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLNNNPLFQYKYLALNMHYVGYILSV
VLLTLPRQHLVQLYLYFVTALLLYAGHQISRDYVRSELESAYEGPMYLEPLSMNRFTTAL
IGQLVVCTLCSCVMKTKQIWLFSAHMLPLLARLCLVPLETIVIINKFAMIFTGLEVLYFL
GSNLLVPYNLAKSAYRELVQVVEVYGLLALGMSLWNQLVVPVLFMVFWLVLFALQIYSYF
STRDQPASRERLLFLFLTSIAECCSTPYSLLGLVFTVSFVALGVLTLCKFYLQGYRAFMN
DPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVVASILQSMLEIADPIVLA
LGASRDKSLWKHFRAVSLCLFLLVFPAYMAYMICQFFHMDFWLLIIISSSILTSLQVLGT
LFIYVLFMVEEFRKEPVENMDDVIYYVNGTYRLLEFVVALCVVAYGVSETIFGEWTVMGS
MIIFIHSYYNVWLRAQLGW

TRC8_N

TRC8_N
PFAM accession number:PF13705
Interpro abstract (IPR025754):

This region is found at the N terminus of the TRC8 protein (Q8WU17). TRC8 is an E3 ubiquitin-protein ligase also known as RNF139. This region contains 12 transmembrane domains and has been suggested to contain a sterol sensing domain [(PUBMED:9689122)]. It has been found that TRC8 protein levels are sterol responsive and that it binds and stimulates ubiquitylation of the endoplasmic reticulum anchor protein INSIG [(PUBMED:20068067)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRC8_N