The domain within your query sequence starts at position 6 and ends at position 125; the E-value for the TRH domain shown below is 5.4e-16.
LMMALALIFVLTGIPKSCALLEAAQEEGAVTPDLPGLEKVQVRPERRFLRKDLQRVRGDL GAALDSWITKRQHPGKREEKEEDVEAEERGDLGEVGAWRPHKRQHPGRRANQDKDSWSDE
TRH |
 |
|---|
| PFAM accession number: | PF05438 |
|---|---|
| Interpro abstract (IPR008857): | This family consists of several thyrotropin-releasing hormone (TRH) proteins. Thyrotropin-Releasing Hormone (TRH) is a tripeptide (pGlu-His-Pro-NH2) hormone that is primarily produced in the paraventricular nucleus of the hypothalamus and represents the most proximal member of the hypothalamic-pituitary-thyroid (HPT) axis. It plays an important role in maintaining the thyroid hormone (TH) homeostasis [ (PUBMED:19179434) ]. |
| GO process: | hormone-mediated signaling pathway (GO:0009755) |
| GO component: | extracellular region (GO:0005576) |
| GO function: | thyrotropin-releasing hormone activity (GO:0008437) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRH