The domain within your query sequence starts at position 76 and ends at position 232; the E-value for the TRI12 domain shown below is 3.4e-9.
IGMPAEKRYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLAISYAVW ATSRSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTLGPML GAFLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKR
TRI12 |
---|
PFAM accession number: | PF06609 |
---|---|
Interpro abstract (IPR010573): | This entry represents a group of major facilitator transporters mostly from fungi, including Str1 from Schizosaccharomyces pombe and Tri12 from Fusarium sporotrichioides. Str1 is involved in the transport of siderophore iron and has a role in iron homeostasis [ (PUBMED:12888492) ]. Tri12 is a trichothecene efflux pump that may play a role in F. sporotrichioides self-protection against trichothecenes [ (PUBMED:10485289) ]. |
GO process: | transmembrane transport (GO:0055085) |
GO function: | transmembrane transporter activity (GO:0022857) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRI12