The domain within your query sequence starts at position 9 and ends at position 164; the E-value for the TRIC domain shown below is 3.1e-77.
YSVLSGAVAAAWNNPLASWLSAMLHCFGGGILSCMLLAESPLKFLTNHTNILLASSIWYI VFFCPRDLVSQGYSYQPIQFLAAGMKEVTRTWKIVGGVSDANSYYRNAWIVMIVVGWARG AGGAVVTACEQLLKGDWKPEGDEWLKMSFPCKITL
TRIC |
---|
PFAM accession number: | PF05197 |
---|---|
Interpro abstract (IPR007866): | TRIC (trimeric intracellular cation) channels are differentially expressed in intracellular stores in animal cell types. TRIC subtypes contain three proposed transmembrane segments, and form homo-trimers with a bullet-like structure. Electrophysiological measurements with purified TRIC preparations identify a monovalent cation-selective channel [ (PUBMED:17611541) ]. |
GO process: | monovalent inorganic cation transport (GO:0015672) |
GO component: | membrane (GO:0016020) |
GO function: | cation channel activity (GO:0005261) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRIC