The domain within your query sequence starts at position 1 and ends at position 80; the E-value for the TRIQK domain shown below is 2.3e-46.

MGRKDSSNTKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLMLAAILA
LLLAFYAFFYLRLSTNIDSD

TRIQK

TRIQK
PFAM accession number:PF15168
Interpro abstract (IPR024842):

TRIQK is a small protein family that is conserved across vertebrates. It is named after the characteristic triple repeat of the sequence QXXK/R that is shared by all family members [ (PUBMED:18828657) ]. The proteins are localised to the endoplasmic reticulum membrane. They may play a role in cell growth and the maintenance of cell morphology [ (PUBMED:18828657) ].

GO component:endoplasmic reticulum membrane (GO:0005789)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRIQK