The domain within your query sequence starts at position 165 and ends at position 285; the E-value for the TRM13 domain shown below is 3.4e-42.

KQQASILGNIEKLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAENVHFILVERVTTRFKV
DGKHRKKDSVFERLQIDIQHLCLNRVPVLREGRLPVVGIGKHLCGVATGVTGDIMWAKSI
S

TRM13

TRM13
PFAM accession number:PF05206
Interpro abstract (IPR007871):

This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [(PUBMED:17242307)]. The alignment contains some conserved cysteines and histidines that might form a zinc binding site.

GO process:tRNA processing (GO:0008033)
GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRM13