The domain within your query sequence starts at position 1176 and ends at position 1231; the E-value for the TRPM_tetra domain shown below is 7.5e-27.

EEQIRMTSERVSEMFFQLKEMNEKVSFIKDSLLSLDSQVGHLQDLSAITVDTLKVL

TRPM_tetra

TRPM_tetra
PFAM accession number:PF16519
Interpro abstract (IPR032415):

This entry represents a short anti-parallel coiled-coil tetramerisation domain of the transient receptor potential cation channel subfamily M member proteins 1-8. It is held together by extensive core packing and interstrand polar interactions. Transient receptor potential (TRP) channels comprise a large family of tetrameric cation-selective ion channels that respond to diverse forms of sensory input. The presence of cytoplasmic domains that direct channel assembly appears to be a feature of many voltage-gated ion channel superfamily members [(PUBMED:18782578)].

GO process:protein tetramerization (GO:0051262)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRPM_tetra