The domain within your query sequence starts at position 1 and ends at position 180; the E-value for the TSC21 domain shown below is 4.3e-107.
MARVVRPQKNHVDLDIYQSSYMVDYKPFGKYKYSRVTPQEQAKLDAQLQSKEFYQPKPNP NPKLEEGYPAFRRPYMTALDLGVPGFFPPQERVTTRKDDGRFTTTCHYAYPASLALYLAQ QDPYWLHQRADFPCLMEPERQPAPEVGKGYLLLPGCLCDHHQRVKVPILNRWGPLMPFYQ
TSC21 |
---|
PFAM accession number: | PF15217 |
---|---|
Interpro abstract (IPR029361): | This entry represents a group of testis-specific proteins named TEX37 (also known as TSC21) [ (PUBMED:17091336) ]. Their function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSC21