SMART: Pfam domain TSKS

The domain within your query sequence starts at position 26 and ends at position 585; the E-value for the TSKS domain shown below is 8.1e-297.

ESRAQLVPEAPGGVTSPAKGITKKKKAVSFHGVEPRMSHEPMHWCLNLKRSSACTNVSLL
NLAAVEPDSSGTDSTTEDSGPLALPGPPASPTTPWAPEDPDITELLSGVNSGLVRAKDSI
TSLKEKTTRVNQHVQTLQSECSVLSENLERRRQEAEELEGYCSQLKGPRPDVLTQENCRK
VTRSVEDAEIKTNVLKQNSALLEEKLRYLQQQLQDETPRRQEAELQELEQKLEAGLSRHG
LSPATPIQGCSGPPGSPEEPPRQRGLSSSGWGMAVRTGEGPSLSEQELQKVSTGLEELRR
EVSSLAARWHQEEGAVQEALRLLGGLGGRLDGFLGQWERAQREQAQSARGLQELRGRADE
LCTMVERSAVSVASLRSELEALGPVKPILEELGRQLQNSRRGADHVLNLDRSAQGPCARC
ASQGQQLSTESLQQLLERALTPLVDEVKQKGLAPACPSCQRLHKKILELERQALAKHVRA
EALSSTLRLAQDEAVRAKNLLLTDKMKPEEKVATLDYMHLKMCSLHDQLSHLPLEGSTGA
MGGGSNGGAPPKRGSPGSEQ

TSKS

PFAM accession number:	PF15358
Interpro abstract (IPR028214):	Testis-specific serine kinase substrate (TSKS) is expressed in the testis and is downregulated in cancerous testicular tissue, in comparison with adjacent normal tissue. TSKS expression is very low to undetectable in seminoma, teratocarcinoma, embryonal, and Leydig cell tumours, while high in testicular tissue adjacent to tumours which contain pre-malignant carcinoma in situ [ (PUBMED:11444856) ]. Recently it has been shown in human testis to be localised to the equatorial segment of ejaculated human sperm. The finding of a TSKS family member in mature sperm suggests that this family of kinases might play a role in sperm function [ (PUBMED:15044604) ]. TSKS is localised during spermiogenesis to the centrioles of post-meiotic spermatids, where it reaches its greatest concentration during the period of flagellogenesis [ (PUBMED:18495105) ].

PFAM accession number:

PF15358

Interpro abstract (IPR028214):

Testis-specific serine kinase substrate (TSKS) is expressed in the testis and is downregulated in cancerous testicular tissue, in comparison with adjacent normal tissue. TSKS expression is very low to undetectable in seminoma, teratocarcinoma, embryonal, and Leydig cell tumours, while high in testicular tissue adjacent to tumours which contain pre-malignant carcinoma in situ [ (PUBMED:11444856) ]. Recently it has been shown in human testis to be localised to the equatorial segment of ejaculated human sperm. The finding of a TSKS family member in mature sperm suggests that this family of kinases might play a role in sperm function [ (PUBMED:15044604) ]. TSKS is localised during spermiogenesis to the centrioles of post-meiotic spermatids, where it reaches its greatest concentration during the period of flagellogenesis [ (PUBMED:18495105) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSKS