The domain within your query sequence starts at position 239 and ends at position 349; the E-value for the TSNAXIP1_N domain shown below is 6.1e-36.
ENRLKEELQKICTCNPQQFNRLQVFGEIFEDICNSSLIFGDLLKEIKDEYELYMAALLDS QPTAQYQRLLAEVRGLENSPRPSCDIDQAKEHLRKVQQAYLEALEHNDKLR
TSNAXIP1_N |
---|
PFAM accession number: | PF15739 |
---|---|
Interpro abstract (IPR032755): | This domain is found at the N terminus of translin-associated factor X-interacting protein, a protein which may play a role in spermatogenesis [ (PUBMED:12036294) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSNAXIP1_N