The domain within your query sequence starts at position 98 and ends at position 209; the E-value for the TSNAXIP1_N domain shown below is 3.5e-33.

ENYLRKELLLLDLSTDSAQELRLQPYREIFEFFIEDFKTYKPLLSSIKNAYEVMLAHQKE
RIRSLEPLKAKIVTMNEDCSERVLAMRAEERYEISVLKKEKMNLLKLIDKKN

TSNAXIP1_N

TSNAXIP1_N
PFAM accession number:PF15739
Interpro abstract (IPR032755):

This domain is found at the N terminus of translin-associated factor X-interacting protein, a protein which may play a role in spermatogenesis [(PUBMED:12036294)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSNAXIP1_N