The domain within your query sequence starts at position 318 and ends at position 432; the E-value for the TTC5_OB domain shown below is 3.3e-44.
TLELKPLSTLQPGVNSGTVVLGKVVFSLTTEEKVPFTFGLVDSDGPCYAVMVYNVVQSWG VLIGDSVAIPEPNLRHHQIRHKGKDYSFSSVRVETPLLLVVNGKPQNSSSQASAT
TTC5_OB |
 |
|---|
| PFAM accession number: | PF16669 |
|---|---|
| Interpro abstract (IPR032076): | This OB fold domain is located at the C terminus of tetratricopeptide repeat protein 5 (TTC5) and is required for effective p53 response [ (PUBMED:22362889) ]. TTC5 can activate the p53 pathway and inhibit AP-1 transcriptional activity [ (PUBMED:24091941) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TTC5_OB