The domain within your query sequence starts at position 128 and ends at position 281; the E-value for the TTD domain shown below is 8e-61.

LGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMYHVKYDDY
PEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEICRKRQTRT
ARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPK

TTD

TTD
PFAM accession number:PF12148
Interpro abstract (IPR021991):

TTD, tandem tudor domain within UHRF1 preferentially binds H3 histone tails trimethylated at Lys-9. It specifically recognises H3 tail peptides with the heterochromatin-associated modification state of trimethylated lysine 9 and unmodified lysine 4 (H3K4me0/K9me3) [(PUBMED:14741369), (PUBMED:21489993)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TTD