The domain within your query sequence starts at position 1 and ends at position 102; the E-value for the TUSC2 domain shown below is 7.4e-32.

MGASGSKARGLWPFASTPGGGGPEAAGSEQSLVRSRARAVPPFVFTRRGSMFYDEDGDLA
HEFYEETIVTKNGQKRAKLRRGIVKLDPPRIHVDFPVILYEV

TUSC2

TUSC2
PFAM accession number:PF15000
Interpro abstract (IPR029393):

Tumour suppressor candidate 2 (also known as Fus1) gene is identified in the human chromosome 3p21.3 region where allele losses and genetic alterations occur early and frequently for many human cancers [(PUBMED:11593436), (PUBMED:15126327)]. FUS1 protein induces apoptosis through the activation of the intrinsic mitochondrial-dependent and Apaf-1-associated pathways and inhibits the function of protein tyrosine kinases including EGFR, PDGFR, AKT, c-Abl, and c-Kit [(PUBMED:18379348)]. In lung cancer cells, Fus1 can modulate their chemosensitivity and enhance the antitumour activity of a conventional chemotherapeutic drug, cisplatin [(PUBMED:17828283)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TUSC2