The domain within your query sequence starts at position 1 and ends at position 32; the E-value for the Takusan domain shown below is 8.2e-9.

HRINFETFMLEMQHDQVMTDLKCMPQDISEAL

Takusan

Takusan
PFAM accession number:PF04822
Interpro abstract (IPR006907):

This domain is found in an number of proteins, including Disks large homologue 5 and members of the takusan gene family [ (PUBMED:17610818) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Takusan