The domain within your query sequence starts at position 49 and ends at position 135; the E-value for the Takusan domain shown below is 2.8e-25.

LRQTSSPVPVISKKQFEKEEKKLIKEIQLTTEETNELRDRLIYVTEGSMNKRPYHRQNPL
YEKLKLKEKEIMTFLHNLEMENMEAQE

Takusan

Takusan
PFAM accession number:PF04822
Interpro abstract (IPR006907): This domain is found in an number of proteins, including Disks large homologue 5 and members of the takusan gene family [(PUBMED:17610818)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Takusan