The domain within your query sequence starts at position 57 and ends at position 135; the E-value for the Takusan domain shown below is 1.3e-24.
LPQAPTINEQEKRHERLEKLKRELQNIKNARDELQGILANYTNKDLNDRINFETFMLEMQ
HDQVMTDLKRMPQDISEAL
Takusan |
 |
---|
PFAM accession number: | PF04822 |
---|
Interpro abstract (IPR006907): |
This domain is found in an number of proteins, including Disks large homologue 5 and members of the takusan gene family [(PUBMED:17610818)].
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Takusan