The domain within your query sequence starts at position 1838 and ends at position 1895; the E-value for the Tantalus domain shown below is 2.9e-28.

LTPMGLPRPKRLKKKEFSLEEIYTNKNYKSPPASRCLETIFEEPKERNGTLISISQQK

Tantalus

Tantalus
PFAM accession number:PF15386
Interpro abstract (IPR028149):

This entry consist of an alpha+beta fold domain found in metazoan proteins such as tantalus from Drosophila [(PUBMED:22186017)]. Tantalus is a potential cofactor involved in sensory organ development. It binds the chromatin protein additional sex combs (Asx) and also binds DNA in vitro [(PUBMED:11397012)]. Proteins containing this domain also include proline-rich protein 14 (PRR14) and related proteins from mammals.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tantalus