The domain within your query sequence starts at position 112 and ends at position 199; the E-value for the Tap-RNA_bind domain shown below is 2.4e-45.

DGTTKNWFKITIPYGRKYDKTWLLSMIQSKCSVPFNPIEFHYENTRAHFFVEDATTASAL
KGVNHKIQDRENRRISIIINASAPPYTV

Tap-RNA_bind

Tap-RNA_bind
PFAM accession number:PF09162
Interpro abstract (IPR015245):

This domain adopts a structure consisting of an alpha+beta sandwich with an antiparallel beta-sheet, arranged in a 2(beta-alpha-beta) motif. It is mainly found in mRNA export factors, which mediate the sequence nonspecific nuclear export of cellular mRNAs as well as the sequence-specific export of retroviral mRNAs bearing the constitutive transport element [(PUBMED:11854490)].

GO process:mRNA export from nucleus (GO:0006406)
GO component:cytoplasm (GO:0005737), nucleus (GO:0005634)
GO function:RNA binding (GO:0003723)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tap-RNA_bind