The domain within your query sequence starts at position 119 and ends at position 202; the E-value for the Tap-RNA_bind domain shown below is 4.8e-37.
LGSWFKVTVPCGRKYDKTQLMNSIHSLCSVPFTPVDFHCDKHRIQFFVPDFRIASALKDI SYKIHNEYFQKIPIFVNPSVAPYS
Tap-RNA_bind |
---|
PFAM accession number: | PF09162 |
---|---|
Interpro abstract (IPR015245): | This domain adopts a structure consisting of an alpha+beta sandwich with an antiparallel beta-sheet, arranged in a 2(beta-alpha-beta) motif. It is mainly found in mRNA export factors, which mediate the sequence nonspecific nuclear export of cellular mRNAs as well as the sequence-specific export of retroviral mRNAs bearing the constitutive transport element [ (PUBMED:11854490) ]. |
GO process: | mRNA export from nucleus (GO:0006406) |
GO component: | cytoplasm (GO:0005737) |
GO function: | RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tap-RNA_bind