The domain within your query sequence starts at position 518 and ends at position 782; the E-value for the TatD_DNase domain shown below is 3.7e-61.

IDTHCHLDMLYSKLSFKGTFTKFRKIYSSSFPKEFQGCISDFCDPRTLTDGLWEELLKED
LVWGAFGCHPHFARYYNESQERKLLHALRHPKAVAFGEMGLDYSHKCTTPVPEQHQVFER
QLKLAVSLKKPLVIHCREADEDLLDIMRKFVPSDYKIHRHCFTGSYSVIEPLLKYFPNMS
VGFTAVLTYSSAWEARDALRQIPLERIIVETDAPYFLPRQVPRSLCQYAHPGLALHTVRE
IARVKEESLSHTLSVLRENTCRLYS

TatD_DNase

TatD_DNase
PFAM accession number:PF01026
Interpro abstract (IPR001130):

This entry represents the TatD family, which includes TatD and many putative deoxyribonucleases and metal-dependent hydrolases. The family is related to a large superfamily of metalloenzymes [(PUBMED:9144792)]. TatD has been shown to be a 3'-5' exonuclease that processes single-stranded DNA in DNA repair [(PUBMED:10747959), (PUBMED:25114049)].

In E. coli TatD is encoded by a operon that encodes Tat proteins, including TatA, TatB, and TatC, for protein transport via the Tat (Twin-Arginine Translocation) pathway. However, TatD is not involved in the protein export in the Tat pathway [(PUBMED:10747959)].

GO function:hydrolase activity, acting on ester bonds (GO:0016788)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TatD_DNase