The domain within your query sequence starts at position 23 and ends at position 322; the E-value for the Tau95 domain shown below is 2.8e-71.
RLVCVEYPGVVRNEAKMLQTLGGEESVSRIYTDPTKRLELYFRPKDPYCHPVCANRFSTS SLLLRIRKRTRRRRGVLGDEAHPQVTFNLEIIGIISTIYKFQGMSDFQYLAVHTEAGGKH VSMYDRVLMRKPEKEEFFHQELPLYIPPPIFSRLDTPVDYFYRPETQHREGYHNPTISGE NLIGLSRARRPHNAIFVNFEDTEVPEQPLEAAVQTWKKACTNPIDQKVEEELRKLFDIRP VWSRNAVKSNVSVHPDKLKILLPYMAYYMITGPWRSLWIRFGYDPRKHPDAKIYQVLDFR
Tau95 |
---|
PFAM accession number: | PF09734 |
---|---|
Interpro abstract (IPR019136): | Transcription factor IIIC (TFIIIC) is a multisubunit DNA binding factor that serves as a dynamic platform for assembly of pre-initiation complexes on class III genes. This entry represents subunit Tfc1/Sfc1 (also known as the tau 95 subunit) which holds a key position in TFIIIC, exerting both upstream and downstream influence on the TFIIIC-DNA complex by rendering the complex more stable [ (PUBMED:12533520) ]. Once bound to tDNA-intragenic promoter elements, TFIIIC directs the assembly of TFIIIB on the DNA, which in turn recruits the RNA polymerase III (pol III) and activates multiple rounds of transcription. This entry represents the HTH domain of transcription factor IIIC subunit 5. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tau95