The domain within your query sequence starts at position 48 and ends at position 209; the E-value for the Taxilin domain shown below is 4.8e-57.

GKEVLLLMQALNTLSTPEEKLAALCKKYADLLEESRNVQKQMKILQKKQAQIVKEKVHLQ
SEHSKAILARSKLESLCRELQRHNKTLKEENMQQAREEEERRKEATAHFQITLNEIQAQL
EQHDIHNAKLRQENIELGEKLKKLIEQYALREEHIDKKIKKL

Taxilin

Taxilin
PFAM accession number:PF09728
Interpro abstract (IPR026183): The taxilin family of proteins includes alpha-, beta- and gamma-taxilins. They bind to members of the syntaxin protein family [(PUBMED:15184072)], which are implicated in intracellular vesicle traffic. Taxilins might therefore be involved in this process. Alpha-taxilin may also be involved in calcium-dependent exocytosis in neuroendocrine cells [(PUBMED:12558796)], while gamma-taxilin (also known as Elrg) may have a role in cell cycle progression [(PUBMED:18068885)].
GO function:syntaxin binding (GO:0019905)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Taxilin