The domain within your query sequence starts at position 248 and ends at position 588; the E-value for the Tcf25 domain shown below is 4.6e-120.

FAFDHNEEYQQAQHKFLVAVESMEPNNIVVLLQTSPYHVDSLLQLSDACRFQEDQEMARD
LIERALYSMECAFHPLFSLTSGTCRLDYRRPENRSFYLTLYKQMSFLEKRGCPRTALEYC
KLILSLEPDEDPLCMLLLIDHLALRARNYEYLIRLFQEWEAHRNLSQLPNFAFSVPLAYF
LLSQQTDLPEHELSSARQQASLLIQQALTMFPGVLMPLLEYCSVRPDATVSNHRFFGPDA
EISQPPALGQLVSLYLGRSHFLWKEPAIMSWLEENVHEVLQAVDAGDPAVEACENRRKVL
YQRAPRNIHRHVILSEIKEAVAALPSDVTTQSVMGFDPLPP

Tcf25

Tcf25
PFAM accession number:PF04910
Interpro abstract (IPR006994):

Members of this family are transcriptional repressors. They may act by increasing histone deacetylase activity at promoter regions [(PUBMED:16574069)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tcf25