The domain within your query sequence starts at position 261 and ends at position 438; the E-value for the Tcp10_C domain shown below is 1.1e-90.

KVERMLSDGRTIITFPNGTRKEISADKKTTLIRFFNGDMKKIKSNQKVIYYYADAQTMHT
TYPDGVEVVQFPNKWTEKFYPDGSKETVFPDGTVKRLKDGCEETVFPDGTFVTVKRNGDK
TIMFSNGEKEIHTARFKRKEFPDGTTKTVYCNGCQETKYASGRVRVKDEKGTVILDWK

Tcp10_C

Tcp10_C
PFAM accession number:PF07202
Interpro abstract (IPR009852): This entry represents a C-terminal domain found in members of the T complex protein 10 family. This domain contains unusual G repeats [(PUBMED:11003675)]. Centromere protein J, a member of the TCP10 family, inhibits microtubule nucleation from the centrosome and depolymerises taxol-stabilised microtubules [(PUBMED:12068715)]. T-complex is involved in spermatogenesis in mice [(PUBMED:15047868)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tcp10_C