The domain within your query sequence starts at position 78 and ends at position 502; the E-value for the Tcp11 domain shown below is 3.9e-105.

LAHEIVVTGDFRINAVELAEGSLEKRVKEIVHKAFWDCLSVQLSEEPPTYDHAIKLVGEI
KETLLSFLLPGHTRLRNQITEVLDLELIKQEAENGALDISKLAEFIIGMMGILCAPARDE
EVKKLKGIKEIVPLFRAIFSVLDLMKVDMANFAISSIRPHLMQQSVEYERRKFQEVLERQ
PNSLDFATQWLEEATNDLLSQKYKHALPAGGGAAGSGDAPLLTPVSVQNFAYLKLLKWDH
FQRPFPETVLMDQSRFQELQLQLEQLAVLGAVLLVTFSTAAPGISGHADFAEKLKMMVKT
LLTDMHLPSFHLEDALASIGEKVCLEVSSCLSLCGSSPFSVAKETVLKGQIQALASPEDP
IRRIMESRIFTFLETYLASGHQKPLPTVPGGLGPIQKELEEVAVKFVRLVNYNKMVFCPY
YDAIL

Tcp11

Tcp11
PFAM accession number:PF05794
Interpro abstract (IPR008862): This family consists of several eukaryotic T-complex protein 11 (Tcp11) related sequences. Tcp11 is only expressed in fertile adult mammalian testes and is thought to be important in sperm function and fertility. The family also contains the Saccharomyces cerevisiae Sok1 protein which is known to suppress cyclic AMP-dependent protein kinase mutants [(PUBMED:8065298)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tcp11