The domain within your query sequence starts at position 30 and ends at position 167; the E-value for the Telomere_Sde2 domain shown below is 3.2e-26.

RDVIYRHCQEQEVPVECFFVTCNGVLVNAGDKVQHGAVYSLEPRLRGGKGGFGSMLRALG
AQIEKTTNREACRDLSGRRLRDVNHEKAMAEWVKQQAEREAEKEQRRLERLQRKLAEPAH
CFTSPDYQRQCHEMAERL

Telomere_Sde2

Telomere_Sde2
PFAM accession number:PF13019
Interpro abstract (IPR024974):

Sde2 has been identified in fission yeast as an important factor in telomere formation and maintenance. This domain is found in the N-terminal section of these nuclear proteins, and is essential for telomeric silencing and genomic stability.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Telomere_Sde2