The domain within your query sequence starts at position 10 and ends at position 182; the E-value for the Ten_N domain shown below is 7.6e-77.
CSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVKDLVHR EADEYTRQGQNFTLRQLGVCESATRRGVAFCAEMGLPHRGYSISAGSDADTENEAVMSPE HAMRLWGRGVKSGRSSCLSSRSNSALTLTDTEHENRSDSESEQPSNNPGQPTL
Ten_N |
---|
PFAM accession number: | PF06484 |
---|---|
Interpro abstract (IPR009471): | Teneurins are a family of phylogenetically conserved transmembrane glycoproteins expressed during pattern formation and morphogenesis [ (PUBMED:11146505) ]. Originally discovered as ten-m and ten-a in The large C-terminal extracellular domain consists of eight EGF-like repeats a region of conserved cysteines and unique YD-repeats. The N-terminal intracellular domain of vertebrate teneurins contains two EF-hand-like calcium-binding motifs and two polyproline regions involved in protein-protein interactions, followed by a single-span transmembrane domain. The intracellular domain is linked to the cytoskeleton through its interaction with the adaptor protein CAP/ponsin and can be cleaved near (or possibly in) the transmembrane domain and transported to the nucleus [ (PUBMED:12361962) (PUBMED:10588872) ], giving teneurins the potential to act as transcription factors [ (PUBMED:12783990) (PUBMED:12783990) ]. There is considerable divergence between intracellular domains of invertebrate and vertebrate teneurins as well as between different invertebrate proteins [ (PUBMED:10341219) (PUBMED:12783990) (PUBMED:16406038) (PUBMED:17095284) (PUBMED:17502993) ]. This domain is found in the intracellular N-terminal region of the Teneurin family. |
GO process: | signal transduction (GO:0007165) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ten_N