The domain within your query sequence starts at position 1 and ends at position 61; the E-value for the Tet_JBP domain shown below is 2.4e-20.

XLGNEEGRPFSGVTCCMDFCAHSHKDIHNMHNGSTVMAVTQIVPRMNNSTSCHYTGLQTL
M

Tet_JBP

Tet_JBP
PFAM accession number:PF12851
Interpro abstract (IPR024779):

This entry represents the catalytic domain from nucleic-acid modifying members of the 2-oxoglutarate (2OG)-Fe(II)-dependent dioxygenase (2OGFeDO) superfamily [ (PUBMED:19411852) ]. These proteins catalyze nucleic acid modifications, such as thymidine hydroxylation during base J synthesis in kinetoplastids [ (PUBMED:20215442) ], and the conversion of 5 methyl-cytosine (5-mC) to 5-hydroxymethyl-cytosine (hmC) [ (PUBMED:19372391) ], or further oxidation to 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) [ (PUBMED:21817016) ]. Metazoan TET proteins contain a cysteine-rich region inserted into the core of the DSBH fold. Vertebrate TET proteins are oncogenes that are mutated in various myeloid cancers [ (PUBMED:21057493) ]. Fungal and algal versions of this family are linked to a predicted transposase and show lineage-specific expansions [ (PUBMED:19411852) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tet_JBP