The domain within your query sequence starts at position 13 and ends at position 193; the E-value for the Tetraspannin domain shown below is 4.3e-28.

VGCCGKYFLFGFNIVFWFSVFLGLIFFLELAAGILAFVFKDWIRDQLNLFINNNVKAYRD
DLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVL
NTQCGYDIRLKLELEQQGSIYTKGCVGQFEKWLQDNLIVVAGVLVGIALLQIFGLCLAQN
L

Tetraspannin

Tetraspannin
PFAM accession number:PF00335
Interpro abstract (IPR018499):

Tetraspanins are a distinct family of proteins, containing four transmembrane domains: a small outer loop (EC1), a larger outer loop (EC2), a small inner loop (IL) and short cytoplasmic tails. They contain characteristic structural features, including 4-6 conserved extracellular cysteine residues, and polar residues within transmembrane domains. A fundamental role of tetraspanins appears to be organizing other proteins into a network of multimolecular membrane microdomains, sometimes called the `tetraspanin web'.

This entry represents tetraspanin proteins. It also recognises a number of peripherins. These are related retinal-specific memebers of the tetraspanin family which are located at the rims of the photoreceptor disks, where they may act jointly in disk morphogenesis [(PUBMED:1610568)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tetraspannin