The domain within your query sequence starts at position 213 and ends at position 403; the E-value for the Tex_N domain shown below is 2.8e-43.

LSERTNIEPWVCANIIRLFNDDNTIPFIVRYRKELINNLDADFLREVRQTLDELRDVAKK
VHSRIQKIKKEGKMSECLLQALLNCKTFEELEHVSAPYKMGSKGTKAQRAKQLGLEGAAW
TLLENPGQLNLLSYIKPDVKGLSELNDIETGVQHILADMIAKDKDTLDFIRGLCKHRYIC
IQSSLAKVSSK

Tex_N

Tex_N
PFAM accession number:PF09371
Interpro abstract (IPR018974):

This presumed domain is found at the N terminus of Q45388. This protein defines a novel family of prokaryotic transcriptional accessory factors [(PUBMED:8755871)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tex_N