The domain within your query sequence starts at position 22 and ends at position 61; the E-value for the Tfb2 domain shown below is 1.6e-14.

EFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRML

Tfb2

Tfb2
PFAM accession number:PF03849
Interpro abstract (IPR004598):

This entry represents the p52/Tfb2 subunit in the TFIIH complex, which is not only required for transcription but also plays a central role in DNA repair. The TFIIH multiprotein complex consists of a 7-subunit core (XPB, p62, p52, p44, p34, and TTDA) that is associated with a 3-subunit CDK-activating kinase module (MAT1, cyclin H and Cdk7) [(PUBMED:21592869), (PUBMED:22308316), (PUBMED:22572993)].

GO process:nucleotide-excision repair (GO:0006289)
GO component:core TFIIH complex (GO:0000439), nucleus (GO:0005634)
GO function:ATP-dependent DNA helicase activity (GO:0004003)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tfb2