The domain within your query sequence starts at position 1 and ends at position 68; the E-value for the Tfb5 domain shown below is 6.8e-27.
MVNVLKGVLIECDPAMKQFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL MDQNAFSL
Tfb5 |
---|
PFAM accession number: | PF06331 |
---|---|
Interpro abstract (IPR009400): | This entry represents TTDA/Tfb5 subunit of TFIIH basal transcription factor complex. These proteins have a structural motif consisting of a 2-layer sandwich structure with an alpha/beta plait topology. Nucleotide excision repair is a major pathway for repairing UV light-induced DNA damage in most organisms. Transcription/repair factor IIH (TFIIH) is essential for RNA polymerase II transcription and nucleotide excision repair. The TFIIH multiprotein complex consists of a 7-subunit core (XPB, p62, p52, p44, p34, and TTDA) that is associated with a 3-subunit CDK-activating kinase module (MAT1, cyclin H and Cdk7) [ (PUBMED:21592869) ]. In humans, defects in TTDA cause the trichothiodystrophy photosensitive (TTDP), an autosomal recessive disease characterised by sulfur-deficient brittle hair and nails, ichthyosis, mental retardation, impaired sexual development, abnormal facies and cutaneous photosensitivity correlated with a nucleotide excision repair (NER) defect [ (PUBMED:15220921) ]. |
GO process: | transcription initiation from RNA polymerase II promoter (GO:0006367), nucleotide-excision repair (GO:0006289) |
GO component: | transcription factor TFIIH core complex (GO:0000439) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tfb5