The domain within your query sequence starts at position 3 and ends at position 79; the E-value for the ThiI domain shown below is 7.7e-8.

ALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEQGVCAADKDCEDAYKVCQ
ILDIPFHQVSYVKEYWN

ThiI

ThiI
PFAM accession number:PF02568
Interpro abstract (IPR020536):

tRNA sulfurtransferase ThiI catalyses the ATP-dependent transfer of a sulfur to tRNA to produce 4-thiouridine in position 8 of tRNAs, which functions as a near-UV photosensor [(PUBMED:11443125), (PUBMED:16855700), (PUBMED:18604845)]. In some bacteria, ThiI is a bifunctional enzyme required for the synthesis of both the 4-thiouridine modification in tRNA and the thiazole moiety in the thiamine biosynthesis pathway [(PUBMED:9209060)].

Three domains of ThiI are essential for the thiolation of tRNA: a THUMP domain that binds tRNA (see IPR004114) [(PUBMED:16343540)], an AANH domain that activates the uridine residue by adenylylation [(PUBMED:18604845)], and a rhodanese domain that transfers sulfur to the activated uridine residue [(PUBMED:11443125)]. Neither the THUMP nor the AANH domain of ThiI are essential for thiamine synthesis, only the rhodanese domain is necessary for synthesis of the thiazole moiety of thiamine [(PUBMED:21724998)].

This entry represents the AANH domain.

GO function:tRNA adenylyltransferase activity (GO:0004810)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ThiI