The domain within your query sequence starts at position 27 and ends at position 256; the E-value for the Thioesterase domain shown below is 3.8e-49.
FKLICFPWAGGGSTHFAKWGRKINGLLEVHAVRLAGRETRFEEPFSNDIYQIAEEVVTAL LPIIRDKAFAFFGHSFGSYIAFITALHLKEKYKMEPLHIFVSSASAPHSEFRPQVPDINK LSEEQIRDHLLIFGGTPKHLIEDQDFLKQCIPLLKADVDIVKKFIFDKPSKALLSRDITC FIGSEDVVKDIEGWKDITSGKFDVLKLPGDHFYLMEPNNEDFIKNYIVKC
Thioesterase |
---|
PFAM accession number: | PF00975 |
---|---|
Interpro abstract (IPR001031): | Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [ (PUBMED:9560421) ]. Thioesterases are required for the addition of the last amino acid to the peptide antibiotic, thereby forming a cyclic antibiotic. Next to the operons encoding these enzymes, in almost all cases, are genes that encode proteins that have similarity to the type II fatty acid thioesterases of vertebrates. |
GO process: | biosynthetic process (GO:0009058) |
GO function: | hydrolase activity, acting on ester bonds (GO:0016788) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thioesterase