The domain within your query sequence starts at position 27 and ends at position 257; the E-value for the Thioesterase domain shown below is 1.7e-53.

FKLICFPWAGGGSTHFAKWGRKINGLLEVHAVRLAGRETRFEEPFSNDIYQIAEEVVTAL
LPIIRDKAFAFFGHSFGSYIAFITALHLKEKYKMEPLHIFVSSASAPHSEFRPQVPDINK
LSEEQIRDHLLIFGGTPKHLIEDQDFLKQCIPLLKADVDIVKKFIFDKPSKALLSRDITC
FIGSEDVVKDIEGWKDITSGKFDVLKLPGDHFYLMEPNNEDFIKNYIVKCL

Thioesterase

Thioesterase
PFAM accession number:PF00975
Interpro abstract (IPR001031):

Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [ (PUBMED:9560421) ]. Thioesterases are required for the addition of the last amino acid to the peptide antibiotic, thereby forming a cyclic antibiotic. Next to the operons encoding these enzymes, in almost all cases, are genes that encode proteins that have similarity to the type II fatty acid thioesterases of vertebrates.

GO process:biosynthetic process (GO:0009058)
GO function:hydrolase activity, acting on ester bonds (GO:0016788)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thioesterase