The domain within your query sequence starts at position 21 and ends at position 115; the E-value for the Thioredox_DsbH domain shown below is 9.8e-10.
IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEF AKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYV
Thioredox_DsbH |
---|
PFAM accession number: | PF03190 |
---|---|
Interpro abstract (IPR004879): | Members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif. The human/rat protein, called SSP411, is specifically expressed in the testis in an age-dependent manner. The SSP411 mRNA is increased during spermiogenesis and is localized in round and elongated spermatids, suggesting a function in fertility regulation [ (PUBMED:15223837) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thioredox_DsbH