The domain within your query sequence starts at position 189 and ends at position 296; the E-value for the Thioredoxin_2 domain shown below is 7.1e-11.

SSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQEFEIIFVSADRSEESFKQYFS
EMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEV

Thioredoxin_2

Thioredoxin_2
PFAM accession number:PF13098
Interpro abstract (IPR012336):

Several biological processes regulate the activity of target proteins through changes in the redox state of thiol groups (S2 to SH2), where a hydrogen donor is linked to an intermediary disulphide protein. Such processes include the ferredoxin/thioredoxin system, the NADP/thioredoxin system, and the glutathione/glutaredoxin system [(PUBMED:15862094)]. Several of these disulphide proteins share a common structure, consisting of a three-layer alpha/beta/alpha core.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thioredoxin_2