The domain within your query sequence starts at position 288 and ends at position 377; the E-value for the Thioredoxin_2 domain shown below is 7e-10.
VKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATVNEALAGRFHI SAFPTLKYFKNGEQQAVPALRTKKKFIEWM
Thioredoxin_2 |
![]() |
---|
PFAM accession number: | PF13098 |
---|---|
Interpro abstract (IPR012336): | Several biological processes regulate the activity of target proteins through changes in the redox state of thiol groups (S2 to SH2), where a hydrogen donor is linked to an intermediary disulphide protein. Such processes include the ferredoxin/thioredoxin system, the NADP/thioredoxin system, and the glutathione/glutaredoxin system [ (PUBMED:15862094) ]. Several of these disulphide proteins share a common structure, consisting of a three-layer alpha/beta/alpha core. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thioredoxin_2