The domain within your query sequence starts at position 873 and ends at position 1173; the E-value for the Tho2 domain shown below is 1.1e-105.

WDDISPQFYTTFWSLTMYDLAVPHTSYEREVNKLKIQMKAVDDSQEMPLNKKKKEKERCT
ALQDKLLEEEKKQTEHVQRVLHRLKLEKDNWLLAKSTKNETITKFLQLCIFPRCIFSAID
SVYCAHFVELVHQQKTPNFSTLLCYDRVFSDIIYMVASFTENEASRYGRFLCCMLETVTR
WHSDRSTYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCL
ETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKKPDLYALAMVYSGQ
L

Tho2

Tho2
PFAM accession number:PF11262
Interpro abstract (IPR021418):

THO and TREX form a eukaryotic complex which functions in messenger ribonucleoprotein metabolism and plays a role in preventing the transcription-associated genetic instability [(PUBMED:16581804)],[(PUBMED:17960421)]. Tho2, along with four other subunits forms THO [(PUBMED:17960421)].

This entry represents a conserved domain found towards the C terminus of these proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tho2